PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00044429-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 689aa    MW: 77863.5 Da    PI: 4.989
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00044429-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.7e-15294337146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r++ T+eE+  +++++ +lG++ W++Ia+ ++ gRt++++k++w++
  PSME_00044429-RA 294 RNKITPEEERVIIELHGRLGNR-WSRIAQSLP-GRTDNEIKNYWRT 337
                       6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.530.206.2E-11158215IPR023393START-like domain
SuperFamilySSF559611.52E-7159215No hitNo description
Gene3DG3DSA:1.10.10.603.6E-8274301IPR009057Homeodomain-like
SuperFamilySSF466898.98E-18274348IPR009057Homeodomain-like
PROSITE profilePS5129423.656289343IPR017930Myb domain
SMARTSM007179.9E-14293341IPR001005SANT/Myb domain
PfamPF002492.8E-13294337IPR001005SANT/Myb domain
CDDcd001679.75E-11298337No hitNo description
Gene3DG3DSA:1.10.10.603.5E-19302339IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MLANPPLCHC PLALWRPSGG QVDQREYDRE IVLNVMGYVE GMLNVMSNAV VAATTTTETN  60
RIEDQENIQQ MVSSLIINRY GLVNLSENVD IGRLQDGWRG EIEEPSSNLS GGSKQSCKAG  120
VAQYLQQGEE AYGEWLQELV GLYHFHSLDD GEREFIKCSA VVVQRVEAPA SIVWSLVRRF  180
NEPQIYKPFV RSCFIRSDHG NVKVGCVRKV RFVSSLLPLP PPPPSKQGQR RSMGTKGPPF  240
TGGAILRIAP PVKGCPLSPM ERRSPCFDGG GGLKRTGKCC RLWWVNYLRP NLKRNKITPE  300
EERVIIELHG RLGNRWSRIA QSLPGRTDNE IKNYWRTRIE KKMNIRPQSC NSSMDAANKV  360
IIERSTTSNS ITGSSQRPSH LDIVEPPTTS LQRKTNEEIE VQTNATPYLQ DDISSQVIPI  420
TEGNYANKLK GEVEGQDNQL FENNLLYNFP VGSLPIFLYS SEFGIDDPTQ DGRMAPSCSY  480
MVDYLEAFSD SETYLNRYSD DFNGIDDDFG EDEKINNGED DFPPNEDLNE TDDEFPPSED  540
VNGNDDDFHP SEDFNGNDDD FPPSEDFNGT EDDFPPSRHV MIASCGRLAN VDICACFSIC  600
SIARDRECRK IVSCFFCLPH PQARKMANNR SLHCVLNIAF RWVKDSSISE LEQLCDELRL  660
MANILFVFFS LYRNLRAVRK RKLNSFGKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1927534440109B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.15e-34myb domain protein 24